IL-36Ra/IL-1F5 Antibody - CD BioSciences

service-banner

IL-36Ra/IL-1F5 Antibody

IL-36Ra/IL-1F5 Antibody

SPA-05904

Size Price
0.1 mg Online Inquiry
0.025 mg Online Inquiry
More Options Online Inquiry
Target Information
Target Name IL-36 Receptor
Gene Abbr. IL36RN
Gene ID 26525
Full Name interleukin 36 receptor antagonist
Alias FIL1, FIL1(DELTA), FIL1D, IL-36Ra, IL1F5
Introduction The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq]
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGA.
Usage
Application WB, IHC
Dilutions Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:500-1:1000)
Reactivity Human, Mouse, Rat
Specificity Specificity of human IL1F5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.