Online Inquiry
IL-36 alpha/IL-1F6 Antibody
SPA-05898
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | IL-36 |
| Gene Abbr. | IL36A |
| Gene ID | 27179 |
| Full Name | interleukin 36 alpha |
| Alias | FIL1, FIL1(EPSILON), FIL1E, IL-1F6, IL1(EPSILON) |
| Introduction | Human interleukin 1 family member #6 [IL-1F6; also Interleukin-36 alpha, IL36A, FIL-1 epsilon (epsilon)] is a member of the IL-1 family of proteins. IL-1 family members include IL-1 beta, IL-1 alpha, IL‑1ra, IL-18 and IL-1F5 through F10. All family members show a 12 beta -strand, beta -trefoil configuration, and all family members are believed to have arisen from a common ancestral gene that has undergone multiple duplications. IL-1F6 is synthesized as a 158 amino acid (aa) protein that contains no signal sequence, no prosegment and no potential N-linked glycosylation site(s). It appears to be actively secreted. When found in cell lysate, it presents as an 18 kDa monomer. |
| Product Details | |
|---|---|
| Host | Mouse |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | IL1F6 (NP_055255.1, 1 a.a. - 158 a.a.) full-length human protein. MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF. |
| Usage | |
|---|---|
| Application | WB |
| Dilutions | Western Blot (1:500) |
| Reactivity | Human |
| Specificity | IL1F6 - interleukin 1 family, member 6 (epsilon). |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.4). |
| Preservative | No Preservative |
| Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.