IL-33 Antibody - CD BioSciences

service-banner

IL-33 Antibody

IL-33 Antibody

SPA-05889

Size Price
0.1 mg Online Inquiry
0.025 mg Online Inquiry
More Options Online Inquiry
Target Information
Target Name IL-33
Gene Abbr. IL33
Gene ID 90865
Full Name interleukin 33
Alias C9orf26, DVS27, IL1F11, NF-HEV, NFEHEV
Introduction Interleukin 33 (IL-33) is a 32kDa proinflammatory cytokine and intracellular nuclear factor with transcriptional regulatory properties. IL-33 is structurally related to IL-1, which induces helper T cells to produce type 2 cytokines and acts through the receptor IL1RL-1 (IL1 receptor-like-1), which is known also as ST2. Binding of IL-33 to this receptor activates NF-kappa-B and MAP kinases and induces in vitro Th2 cells to produce cytokines. In vivo, IL-33 induces expression of IL-4, IL-5, IL-13 and leads to severe pathological changes in mucosal organs and in vitro, it can be divided to N-terminal fragment of 12kDa and C-terminal fragment of 18kDa by cleavage of caspase-1.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: STVECFAFGISGVQKYTRALHDSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDG.
Usage
Application IF, IHC
Dilutions Immunohistochemistry (1:500-1:1000)
Reactivity Human
Specificity Specificity of human IL-33 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.