Online Inquiry
IL-31RA Antibody
SPA-05872
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | IL-31 Receptor |
| Gene Abbr. | IL31RA |
| Gene ID | 133396 |
| Full Name | interleukin 31 receptor A |
| Alias | CRL, CRL3, GLM-R, GLMR, GPL |
| Introduction | IL-31 RA, also known as Gp130-Like Monocyte Receptor (GLM-R) and GPL, is a member of the type I cytokine receptors and is closely related to GP-130. The heterodimeric complex of IL-31 RA and OSM-R functions as the signaling receptor for IL-31. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: ILKPCSTPSDKLVIDKLVVNFGNVLQEIFTDEARTGQENNLGGEKNGYVTCPFRPDCPLGKSFEELPVSPEIPPRKSQYLR. |
| Usage | |
|---|---|
| Application | IHC |
| Dilutions | Immunohistochemistry (1:200-1:500) |
| Reactivity | Human |
| Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.