Online Inquiry
IL-22BP/IL22 RA2 Antibody
SPA-05821
| Size | Price |
| 0.1 mL | Online Inquiry |
| 25 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | IL-22 Receptor |
| Gene Abbr. | IL22RA2 |
| Gene ID | 116379 |
| Full Name | interleukin 22 receptor subunit alpha 2 |
| Alias | CRF2-10, CRF2-S1, CRF2X, IL-22BP, IL-22R-alpha-2 |
| Introduction | A novel cytokine, designated IL-TIF for IL-10 related T cell-derived inducible factor and IL-22, was recently identified. The receptor for IL-22 (IL-22R, also termed CRF2-9 and IL-TIF-R1 chain) is a new member of the class II cytokine receptor family. IL-22R forms a complex with IL-10 receptor beta chain and mediates IL-22 signaling. IL-22 and its receptor activate JAK-STAT signaling pathway. IL22R is expressed in normal liver and kidney and their cell lines HepG2 and TK-10. A soluble form of IL-22 receptor, also termed IL-22 binding protein (IL-22BP) and IL-22 receptor-alpha 2 (IL-22RA2), was identified very recently. IL-22BP prevents binding of IL-22 to the functional cell surface IL-22R complex and neutralizes IL-22 activity. LPS induces IL-22 expression, which indicates the role of IL-22 in inflammatory response. |
| Product Details | |
|---|---|
| Host | Goat |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptide RVQFQSRNFHNILQWQPGRALTGNSSVY-C corresponding to 33-60 residues of N-terminus of human IL-22R-alpha-2 protein with cysteine added for conjugation to a carrier protein. |
| Usage | |
|---|---|
| Application | ELISA, IHC |
| Dilutions | ELISA (1:50000); Immunohistochemistry (1:150) |
| Reactivity | Human, Mouse, Rat |
| Specificity | IL22 RA2. |
| Storage & Handling | |
|---|---|
| Storage Buffer | 10 mM KHPO4 and 0.14 M NaCl, pH 7.2. |
| Preservative | 0.1% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.