Online Inquiry
IL-21R Antibody
SPA-05791
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | IL-21 Receptor |
| Gene Abbr. | IL21R |
| Gene ID | 50615 |
| Full Name | interleukin 21 receptor |
| Alias | CD360, IMD56, NILR |
| Introduction | A novel cytokine related to IL-2 and IL-15 was recently identified and designated IL-21. The receptor for IL-21 (IL-21R, also termed NILR for novel Interleukin receptor) is a new member of the class I cytokine receptor family. IL-21R forms a complex with the common cytokine receptor gamma chain, gammac, and mediates IL-21 signaling. Both IL-21R and the gammac are necessary for the IL-21 function. IL-21 and its receptor activate JAK-STAT signaling pathway. IL-21R is expressed in spleen, thymus, natural killer (NK), T and B cell lines. IL-21 plays a role in the proliferation and maturation of NK, B and T cell populations. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptide: CVLETRSPNPSILSLTWQDEYEELQDQETF, corresponding to N-term amino acids 35-65 of Mouse IL21 Receptor. |
| Usage | |
|---|---|
| Application | ELISA, IHC |
| Dilutions | ELISA (1:100000); Immunohistochemistry (1:10-1:500) |
| Reactivity | Mouse, Human, Rat |
| Specificity | IL21 Receptor. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2). |
| Preservative | 0.1% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.