Online Inquiry
IL-18 BPa/IL18BP Antibody
SPA-05708
| Size | Price |
| 0.1 mg | Online Inquiry |
| 0.025 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | IL-18 BP |
| Gene Abbr. | IL18BP |
| Gene ID | 10068 |
| Full Name | interleukin 18 binding protein |
| Alias | FVH, IL18BPa |
| Introduction | Interleukin-18 is a cytokine and acts as an early signal in the development of the helper T cell (Th1) response. Interleukin-18 Binding Protein (IL-18BP) binds IL-18 and neutralizes the biological activity of IL-18 in vitro. IL-18BP is expressed in the spleen, belongs to the immunoglobulin superfamily, and has limited homology to the IL-1 type II receptor. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: RLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG. |
| Usage | |
|---|---|
| Application | IHC |
| Dilutions | Immunohistochemistry (1:500-1:1000) |
| Reactivity | Human |
| Specificity | Specificity of human IL-18 BPa/IL18BP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.