Online Inquiry
IL-17RB Antibody
SPA-05699
| Size | Price |
| 100 µg | Online Inquiry |
| 25 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | IL-17 Receptor |
| Gene Abbr. | IL17RB |
| Gene ID | 55540 |
| Full Name | interleukin 17 receptor B |
| Alias | CRL4, EVI27, IL17BR, IL17RH1 |
| Introduction | The interleukin 17 (IL-17) family of cytokines, comprising six members (IL-17, IL-17B through IL-17F), are structurally related proteins with a conserved cysteine-knot structure. These proinflammatory cytokines can induce local cytokine productions and are involved in the regulation of the immune response. The cognate receptors activated by some of these cytokines have been identified. Interleukin-17 B Receptor (IL-17 RB), also known as IL-17Rh1, IL-17ER and EVI27, represents the second receptor of the IL-17 family of cytokines to be recognized. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: QCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPG. |
| Usage | |
|---|---|
| Application | WB, IHC |
| Dilutions | Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:20-1:50) |
| Reactivity | Human |
| Specificity | Specificity of human IL-17 RB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.