Online Inquiry
IL-1 RII Antibody
SPA-05546
| Size | Price |
| 100 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | IL-1 Receptor |
| Gene Abbr. | IL1R2 |
| Gene ID | 7850 |
| Full Name | interleukin 1 receptor type 2 |
| Alias | CD121b, CDw121b, IL-1R-2, IL-1RT-2, IL-1RT2 |
| Introduction | The Interleukin 1 receptor type I (IL-1R1) belongs to the IL-1 receptor family. IL-1R1 binds to IL-1 alpha, IL-1 beta, and interleukin-1 receptor antagonist protein (IL-1RA). IL-1RA regulates IL-1 ligand biological activity by a competitive interaction for IL-1R1. Upon IL-1 stimulation, adaptor molecule MyD88 is first recruited to the IL-1R1-IL1R accessory protein complex, followed by the recruitment of two serine-threonine kinases, IRAK4 and IRAK, and the adaptor protein TRAF6, resulting in activation of the NF-kB pathway. Stimulation of IL-1R1, leads to activation of the transcription factors NF-B, ATF, and AP-1. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: GALWLLPALQEDSGTYVCTTRNASYCDKMSIELRVFENTDAFLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDK. |
| Usage | |
|---|---|
| Application | WB, IHC |
| Dilutions | Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:50-1:200) |
| Reactivity | Human |
| Specificity | Specificity of human IL-1 RII antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.