Online Inquiry
IKBKAP Antibody
SPA-05445
| Size | Price |
| 0.1 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | IKBKAP |
| Gene Abbr. | ELP1 |
| Gene ID | 8518 |
| Full Name | elongator complex protein 1 |
| Alias | DYS, FD, IKAP, IKBKAP, IKI3 |
| Introduction | The protein encoded by this gene is a scaffold protein and a regulator for 3 different kinases involved in proinflammatory signaling. This encoded protein can bind NF-kappa-B-inducing kinase (NIK) and IKKs through separate domains and assemble them into an active kinase complex. Mutations in this gene have been associated with familial dysautonomia. [provided by RefSeq] |
| Product Details | |
|---|---|
| Host | Mouse |
| Clonality | Monoclonal |
| Clone No. | 6G9 |
| Isotype | IgG1 Kappa |
| Immunogen | IKBKAP (NP_003631, 1242 a.a. ~ 1331 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VLFLFEFDEQGRELQKAFEDTLQLMERSLPEIWTLTYQQNSATPVLGPNSTANSIMASYQQQKTSVPVLDAELFIPPKINRRTQWKLSLL. |
| Usage | |
|---|---|
| Application | WB, ELISA, IF, IHC |
| Reactivity | Human, Mouse |
| Specificity | IKBKAP - inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein. |
| Storage & Handling | |
|---|---|
| Storage Buffer | In 1X PBS, pH 7.4. |
| Preservative | No Preservative |
| Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.