HYAL3 Antibody - CD BioSciences

service-banner

HYAL3 Antibody

HYAL3 Antibody

SPA-05375

Size Price
0.1 mL Online Inquiry
25 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name HYAL3
Gene Abbr. HYAL3
Gene ID 24142
Full Name N-alpha-acetyltransferase 80, NatH catalytic subunit
Alias HYAL-3, LUCA-3, LUCA3
Introduction This gene encodes a protein which is similar in structure to hyaluronidases. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. However, this protein has not yet been shown to have hyaluronidase activity. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. [provided by RefSeq]
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen The immunogen for this antibody is HYAL3. Peptide sequence RAAMACSHQRCHGHGRCARRDPGQMEAFLHLWPDGSLGDWKSFSCHCYWG. The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Dilutions Western Blot (1:1000)
Reactivity Human, Mouse, Porcine, Bovine, Canine, Equine, Sheep
Storage & Handling
Storage Buffer PBS and 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at -20 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.