Online Inquiry
HUWE1 Antibody
SPA-05370
| Size | Price |
| 100 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | HUWE1 |
| Gene Abbr. | HUWE1 |
| Gene ID | 10075 |
| Full Name | HECT, UBA and WWE domain containing E3 ubiquitin protein ligase 1 |
| Alias | ARF-BP1, HECTH9, HSPC272, Ib772, LASU1 |
| Introduction | The HECT domain-containing ubiquitin E3 ligase HECTH9 (also known as HUWE1, ARF-BP1, URE-B1, Mule, and LASU1) is critical for the ubiquitination and proteasomal degradation of many target proteins, and is involved in the regulation of a variety of cellular processes, including DNA replication and base excision repair, cellular proliferation, differentiation, and apoptosis. HECTH9 contains two Armadillo (ARM) repeat-like domains (ARLD1 and ARLD2), a ubiquitin-associated (UBA) domain, a WWE domain, a well-conserved BH3 domain, and a catalytic HECT domain that facilitates ubiquitination of target proteins. HECTH9 has been shown to polyubiquitinate p53, Miz1 N-Myc, Mcl-1 Cdc 6 and DNA polymerase beta through K48-mediated linkage, thereby targeting these proteins for proteosomal degradation. The tumor suppressor protein ARF (known as p14 ARF in humans and p19 ARF in mice) binds to and inhibits the uibiquitin ligase activity toward p53, resulting in stabilization of p53 and induction of apoptosis. HECTH9 has also been shown to polyubiquitinate c-Myc through K63-linkage, which is required for recruitment of p300, activation of c-Myc target genes, and induction of cellular proliferation. HECTH9 is overexpressed in colon, lung, and breast cancer. In addition, defects in HECTH9 result in mental retardation syndromic X-linked Turner type (MRXST) and mental retardation X-linked type 17 (MRX17) syndromes. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: SGSSTTRLTQGIGRSQRTLRQLTANTGHTIHVHYPGNRQPNPPLILQRLLGPSAAADILQLSSSLPLQSRGRARLLVGNDDVHIIARSDDELLDDFFHDQSTATSQAGTLSSIPTALTRWTEECKVLDAESMHDCVSVVKVSIVNHLE. |
| Usage | |
|---|---|
| Application | IF, IHC |
| Dilutions | Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:50-1:200) |
| Reactivity | Human, Mouse |
| Specificity | Specificity of human HUWE1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.