Online Inquiry
HUNK Antibody
SPA-05350
| Size | Price |
| 0.1 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | HUNK |
| Gene Abbr. | HUNK |
| Gene ID | 30811 |
| Full Name | hormonally up-regulated Neu-associated kinase |
| Introduction | HUNK, an AMPK/SNF1-type protein kinase, contains a domain homologous to SNF1, a protein involved in the response to nutritional stress in yeast. HUNK has been shown to participate in vesicular transport. Additionally, functional studies in mice suggest that HUNK regulates endocytosis via interaction with rabaptin-5 protein and induces changes in mammary glands during pregnancy. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: SSFPDKDSFGCRNIFRKTSDSNCVASSSMEFIPVPPPRTPRIVKKPEPHQ PGPGSTGIPHKEDPLMLDMVRSFESVDR. |
| Usage | |
|---|---|
| Application | IF, IHC |
| Dilutions | Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:200-1:500) |
| Reactivity | Human |
| Specificity | Specificity of human HUNK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.