HtrA2/Omi Antibody - CD BioSciences

service-banner

HtrA2/Omi Antibody

HtrA2/Omi Antibody

SPA-05346

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name HtrA2/Omi
Gene Abbr. HTRA2
Gene ID 27429
Full Name HtrA serine peptidase 2
Alias MGCA8, OMI, PARK13, PRSS25
Introduction High temperature requirement protein A2 (HtrA2)/Omi is a serine protease with homology to the E. coli HtrA protein (DegP) and is thought to be involved in apoptosis and stress-induced degradation of misfolded proteins. While HtrA2 was orignally identified to be present in either the nucleus (1) or endoplasmic reticulum subsequent studies have shown that it localizes in mitochondria and is released during apoptosis. HtrA2 is produced as a 50 kDa zymogen that is cleaved to generate a 36 kDa mature protein that exposes an amino terminal motif (AVPS) resembling that of the IAP inhibitor Smac/Diablo. Like Smac, interaction between HtrA2 and IAP family members, such as XIAP, antagonizes their inhibition of caspase activity and protection from apoptosis. Interestingly, HtrA2 knock-out mice did not show signs of reduced apoptosis, but rather had a loss of neurons in the striatum and a Parkinson's-like phenotype, suggesting that HtrA2 might have a neuroprotective function. This activity is associated with the protease activity of HtrA2. Furthermore, research studies have shown that loss of function mutations in the HtrA2 gene are associated with Parkinson's disease.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to the following amino acid sequence: RLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSP.
Usage
Application IF
Dilutions Immunofluorescence (0.25-2 µg/mL)
MW(KDa) 36
Reactivity Human, Mouse, Rat
Specificity Specificity of human HTRA2/Omi antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.