Online Inquiry
HSP40/DNAJB1 Antibody
SPA-05295
Size | Price |
0.1 mL | Online Inquiry |
25 µL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | HSP40/DNAJB1 |
Gene Abbr. | DNAJB1 |
Gene ID | 3337 |
Full Name | DnaJ heat shock protein family (Hsp40) member B1 |
Alias | HSPF1, Hdj1, Hsp40, RSPH16B, Sis1 |
Introduction | Heat shock protein 40 kDa (HSP40) is the human homologue of the bacterial DnaJ heat shock protein. HSP40, also known as HSPF1 and DnaJ Homolog subfamily B member 1 (DNAJB1), is a 340 amino acid, 40 kDa member of the heat shock protein family. Heat shock proteins (HSPs) are a highly conserved family of stress response proteins. HSPs function primarily as molecular chaperones, facilitating the folding of other cellular proteins, preventing protein aggregation, or targeting improperly folded proteins to specific degradative pathways. Heat Shock Proteins are ubiquitously expressed in all organisms. They are induced in response to various types of environmental stresses like heat, cold, and oxygen deprivation. HSP40 is a stress inducible chaperone that co-localizes with HSP70 and can bind unfolded proteins and prevent protein denaturation and aggregation. The conserved amino terminal J domain can interact with HSP70 and stimulate its ATPase activity. Human HSP40 shares 95% amino acid identity with mouse and rat HSP40. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: DPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDL. |
Usage | |
---|---|
Application | WB, IF, IHC |
Dilutions | Western Blot (0.04-0.4 µg/mL); Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:200-1:500) |
Reactivity | Human, Mouse, Rat |
Specificity | Specificity of human HSP40/DNAJB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.