HSP40/DNAJB1 Antibody - CD BioSciences

service-banner

HSP40/DNAJB1 Antibody

HSP40/DNAJB1 Antibody

SPA-05295

Size Price
0.1 mL Online Inquiry
25 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name HSP40/DNAJB1
Gene Abbr. DNAJB1
Gene ID 3337
Full Name DnaJ heat shock protein family (Hsp40) member B1
Alias HSPF1, Hdj1, Hsp40, RSPH16B, Sis1
Introduction Heat shock protein 40 kDa (HSP40) is the human homologue of the bacterial DnaJ heat shock protein. HSP40, also known as HSPF1 and DnaJ Homolog subfamily B member 1 (DNAJB1), is a 340 amino acid, 40 kDa member of the heat shock protein family. Heat shock proteins (HSPs) are a highly conserved family of stress response proteins. HSPs function primarily as molecular chaperones, facilitating the folding of other cellular proteins, preventing protein aggregation, or targeting improperly folded proteins to specific degradative pathways. Heat Shock Proteins are ubiquitously expressed in all organisms. They are induced in response to various types of environmental stresses like heat, cold, and oxygen deprivation. HSP40 is a stress inducible chaperone that co-localizes with HSP70 and can bind unfolded proteins and prevent protein denaturation and aggregation. The conserved amino terminal J domain can interact with HSP70 and stimulate its ATPase activity. Human HSP40 shares 95% amino acid identity with mouse and rat HSP40.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: DPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDL.
Usage
Application WB, IF, IHC
Dilutions Western Blot (0.04-0.4 µg/mL); Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:200-1:500)
Reactivity Human, Mouse, Rat
Specificity Specificity of human HSP40/DNAJB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.