Online Inquiry
HRSP12 Antibody
SPA-05249
Size | Price |
0.1 mL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | HRSP12 |
Gene Abbr. | HRSP12 |
Gene ID | 10247 |
Full Name | reactive intermediate imine deaminase A homolog |
Alias | HRSP12, P14.5, PSP, UK114, hp14.5 |
Introduction | HRSP12 is an endoribonuclease responsible for the inhibition of the translation by cleaving mRNA.HRSP12 inhibits cell-free protein synthesis. HRSP12 cleaves phosphodiester bonds only in single-stranded RNA. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: GCDFTNVVKTTVLLADINDFNTVNEIYKQYFKSNFPARAAYQVAALPKGSRIEIEAVAIQGP. |
Usage | |
---|---|
Application | WB, IHC |
Dilutions | Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:1000-1:2500) |
Reactivity | Human, Mouse, Rat |
Specificity | Specificity of human HRSP12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.