Online Inquiry
HPK1/MAP4K1 Antibody
SPA-05239
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | HPK1 |
| Gene Abbr. | MAP4K1 |
| Gene ID | 11184 |
| Full Name | mitogen-activated protein kinase kinase kinase kinase 1 |
| Alias | HPK1 |
| Introduction | Hematopoietic progenitor kinase 1 (HPK1) is a member of the germinal center kinases that is predominantly expressed in hematopoietic cells. HPK1 is a key component linking T or B cell receptors to SAPK/JNK and IkappaB kinase pathways in lymphocytes. Through its proline-rich motif, HPK1 associates with multiple SH3 domain-containing adaptor proteins, including GRB2, Nck, Crk, SLP-76, and BLNK. Phosphorylation of Tyr379 by Syk is necessary for HPK1 association with BLNK and SLP-76, as well as for HPK1 activity. Caspase cleavage of HPK1 also modulates the biological function of HPK1. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: LDKLKNPGKGPSIGDIEDEEPELPPAIPRRIRSTHRSSSLGIPDADCCRRHMEFRKLRGMETRPPANTARLQPPRDLRSSSPRKQLSESSDDDYDDVDIPTPAEDTPPPLPPKPKFRSPS. |
| Usage | |
|---|---|
| Application | IHC |
| Dilutions | Immunohistochemistry (1:50-1:200) |
| MW(KDa) | 97 |
| Reactivity | Human |
| Specificity | Specificity of human MAP4K1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.