HOP Antibody - CD BioSciences

service-banner

HOP Antibody

HOP Antibody

SPA-05229

Size Price
0.05 mg Online Inquiry
0.2 mg Online Inquiry
More Options Online Inquiry
Target Information
Target Name HOP
Gene Abbr. HOPX
Gene ID 84525
Full Name HOP homeobox
Alias CAMEO, HOD, HOP, LAGY, NECC1
Introduction The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of this gene in malignant conversion of placental trophoblasts. Studies in mice suggested that this protein may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development. Multiple alternatively spliced transcript variants encoding the same protein have been observed, the full-length nature of only some has been determined.
Product Details
Host Mouse
Clonality Monoclonal
Clone No. 3D6
Isotype IgG1 Kappa
Immunogen HOP (AAH14225, 1 a.a. ~ 73 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVID.
Usage
Application WB, ELISA
Dilutions Western Blot (1:500)
Reactivity Human
Specificity HOP - homeodomain-only protein.
Storage & Handling
Storage Buffer In 1X PBS, pH 7.4.
Preservative No Preservative
Storage Temp. Aliquot and store at -20 °C or -80 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.