Online Inquiry
HOP Antibody
SPA-05229
| Size | Price |
| 0.05 mg | Online Inquiry |
| 0.2 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | HOP |
| Gene Abbr. | HOPX |
| Gene ID | 84525 |
| Full Name | HOP homeobox |
| Alias | CAMEO, HOD, HOP, LAGY, NECC1 |
| Introduction | The protein encoded by this gene is a homeodomain protein that lacks certain conserved residues required for DNA binding. It was reported that choriocarcinoma cell lines and tissues failed to express this gene, which suggested the possible involvement of this gene in malignant conversion of placental trophoblasts. Studies in mice suggested that this protein may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development. Multiple alternatively spliced transcript variants encoding the same protein have been observed, the full-length nature of only some has been determined. |
| Product Details | |
|---|---|
| Host | Mouse |
| Clonality | Monoclonal |
| Clone No. | 3D6 |
| Isotype | IgG1 Kappa |
| Immunogen | HOP (AAH14225, 1 a.a. ~ 73 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVID. |
| Usage | |
|---|---|
| Application | WB, ELISA |
| Dilutions | Western Blot (1:500) |
| Reactivity | Human |
| Specificity | HOP - homeodomain-only protein. |
| Storage & Handling | |
|---|---|
| Storage Buffer | In 1X PBS, pH 7.4. |
| Preservative | No Preservative |
| Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.