Online Inquiry
HLA C Antibody
SPA-05179
Size | Price |
0.025 mL | Online Inquiry |
0.1 mL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | HLA C |
Gene Abbr. | HLA-C |
Gene ID | 3107 |
Full Name | major histocompatibility complex, class I, C |
Alias | D6S204, HLA-JY3, HLAC, HLC-C, MHC |
Introduction | HLA-C belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domain, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Over one hundred HLA-C alleles have been described [provided by RefSeq] |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Immunogen | Synthetic peptide directed towards the HLA C-terminal region of HLA C. Peptide sequence: PPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVET The peptide sequence for this immunogen was taken from within the described region. |
Usage | |
---|---|
Application | WB |
Reactivity | Human, Porcine, Rabbit |
Storage & Handling | |
---|---|
Storage Buffer | PBS, 2% Sucrose. |
Preservative | 0.09% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.