HER2/ErbB2 Antibody - CD BioSciences

service-banner

HER2/ErbB2 Antibody

HER2/ErbB2 Antibody

SPA-04982

Size Price
100 µg Online Inquiry
25 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name HER2/ErbB2
Gene Abbr. ERBB2
Gene ID 2064
Full Name erb-b2 receptor tyrosine kinase 2
Alias CD340, HER-2, HER-2/neu, HER2, MLN 19
Introduction The ErbB2 (HER2) proto-oncogene encodes a 185 kDa transmembrane, receptor-like glycoprotein with intrinsic tyrosine kinase activity. While ErbB2 lacks an identified ligand, ErbB2 kinase activity can be activated in the absence of a ligand when overexpressed and through heteromeric associations with other ErbB family members. Amplification of the ErbB2 gene and overexpression of its product are detected in almost 40% of human breast cancers. Binding of the c-Cbl ubiquitin ligase to ErbB2 at Tyr1112 leads to ErbB2 poly-ubiquitination and enhances degradation of this kinase. ErbB2 is a key therapeutic target in the treatment of breast cancer and other carcinomas and targeting the regulation of ErbB2 degradation by the c-Cbl-regulated proteolytic pathway is one potential therapeutic strategy. Phosphorylation of the kinase domain residue Tyr877 of ErbB2 (homologous to Tyr416 of pp60c-Src) may be involved in regulating ErbB2 biological activity. The major autophosphorylation sites in ErbB2 are Tyr1248 and Tyr1221/1222; phosphorylation of these sites couples ErbB2 to the Ras-Raf-MAP kinase signal transduction pathway.
Product Details
Host Mouse
Clonality Monoclonal
Clone No. CL0268
Isotype IgG1
Immunogen Recombinant Protein corresponding to amino acids: YNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFGAPHR.
Usage
Application WB, IHC
Dilutions Western Blot (1 µg/mL); Immunohistochemistry (1:50-1:200)
MW(KDa) 185
Reactivity Human
Specificity Specificity of human ErbB2/Her2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.