GSK-3β Antibody - CD BioSciences

service-banner

GSK-3β Antibody

GSK-3β Antibody

SPA-04889

Size Price
0.025 mL Online Inquiry
0.1 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name GSK-3
Gene Abbr. GSK3B
Gene ID 2932
Full Name glycogen synthase kinase 3 beta
Introduction Glycogen synthase kinase-3 (GSK-3) was initially identified as an enzyme that regulates glycogen synthesis in response to insulin. GSK-3 is a ubiquitously expressed serine/threonine protein kinase that phosphorylates and inactivates glycogen synthase. GSK-3 is a critical downstream element of the PI3K/Akt cell survival pathway whose activity can be inhibited by Akt-mediated phosphorylation at Ser21 of GSK-3α and Ser9 of GSK-3β. GSK-3 has been implicated in the regulation of cell fate in Dictyostelium and is a component of the Wnt signaling pathway required for Drosophila, Xenopus, and mammalian development. GSK-3 has been shown to regulate cyclin D1 proteolysis and subcellular localization.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: SGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGS.
Usage
Application WB, IF, IHC
Dilutions Western Blot (0.04-0.4 µg/mL); Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:50-1:200)
MW(KDa) 46
Reactivity Human, Mouse, Rat
Specificity Specificity of human, mouse, rat GSK-3 beta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.