Online Inquiry
GRTP1 Antibody
SPA-04875
| Size | Price |
| 0.1 mg | Online Inquiry |
| 0.025 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | GRTP1 |
| Gene Abbr. | GRTP1 |
| Gene ID | 79774 |
| Full Name | growth hormone regulated TBC protein 1 |
| Alias | TBC1D6 |
| Introduction | Growth hormone regulated TBC protein 1 (GRTP1) was identified through microarray analysis as a gene whose expression is regulated by growth hormone (GH). It contains the TBC signature motif of GTPase activator proteins of Rab-like small GTPases. GRTP1 mRNA is expressed at highest levels in testes, and is also present in kidney, lung, liver, and intestine. Administration of GH to mice resulted in an increase in GRTP1 mRNA in testes, but a decrease of GRTP1 mRNA in kidney and liver. GRTP1 was identified as an HIV dependency factor (HDF), suggesting that GRTP1 may be an important drug target in HIV treatment. At least three isoforms of GRTP1 are known to exist; this antibody should recognize all isoforms. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Immunogen | Synthetic peptide directed towards the middle region of human GRTP1. Peptide sequence: LEHRARVWMVLSGAQAQMDQNPGYYHQLLQGERNPRLEDAIRTDLNRTFP The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Reactivity | Human |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS, 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.