GPRC6A Antibody - CD BioSciences

service-banner

GPRC6A Antibody

GPRC6A Antibody

SPA-04812

Size Price
0.05 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name GPRC6A
Gene Abbr. GPRC6A
Gene ID 222545
Full Name G protein-coupled receptor class C group 6 member A
Alias GPCR, bA86F4.3
Introduction GPRC6A has been shown to bind to L-alpha-amino acids. Recently GPRC6A has been suggested to be a calcium-sensing receptor (Pi et al. 2005).
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Immunogen Synthetic peptide directed towards the C-terminal region of GPRC6A. Peptide sequence: NVTMTNPSSSGKSATWQKSKDLQAQAFAHICRENATSVSKTLPRKRMSSI The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Reactivity Human, Equine
Storage & Handling
Storage Buffer PBS, 2% sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.