Online Inquiry
GPR64 Antibody
SPA-04747
| Size | Price |
| 100 µL | Online Inquiry |
| 25 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | GPR64 |
| Gene Abbr. | ADGRG2 |
| Gene ID | 10149 |
| Full Name | adhesion G protein-coupled receptor G2 |
| Alias | CBAVDX, EDDM6, GPR64, HE6, TM7LN2 |
| Introduction | GPR64 (G-Protein coupled Receptor 64; also HE6) is a 110 kDa (predicted) member of the B class of GCPRs. Within this class GPR64 belongs to a Large N-termini family-B 7-transmembrane (LNB-7TM) subclass of receptors (also known as adhesion-GCPRs). GPR64 has restricted expression, being found in stereocilia cell membranes of epididymal caput epithelial cells and, to a limited extent, on osteoblasts. The function of GPR64 is somewhat unclear, but in the epididymis, it may be involved in fluid transport. Mature human GPR64 is a 980 amino acid (aa) 7-TM glycoprotein (SwissProt Q8IZP9). It contains an extended extracellular N-teminus (aa 38-627), seven consecutive TM segments (aa 628-878) and a C-terminal cytoplasmic tail (aa 879-1010). The extended extracellular region possesses a juxtamembrane GPS domain (aa 567-618) that serves as a proteolytic cleavage site. Enzymatic activity here generates a 180 kDa soluble form that stays associated with a 40 kDa membrane-embedded fragment. Notably, isolation of the membrane fragment gives rise to oligomers that run at > 250 kDa in SDS-PAGE. There are multiple splice variants. The one used for immunization to generate this antibody contains a deletion of aa 88-101 (RefSeq NP_001073328). Four other splice forms show single block deletions of aa 65-67, 51-66, 52-75, and 906-956, respectively. Three others possesses aa substitutions; a 20 aa block for aa 52-101, and a common 12 aa block that can substitute for either aa 68-101 or aa 52-101. Over aa 38-64 and 68-553 of RefSeq NP_001073328, human and mouse GPR64 share 69% aa sequence identity. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to the following amino acid sequence: NASGVKPQRNICNLSSICNDSAFFRGEIMFQYDKESTVPQNQHITNGTLTGVLSLSELKRSELNKTLQTLSETYFIMCATAEAQSTLNCTFTIKLNNTMNACAVIAALERVKIRPMEHCCCSVRIPCP. |
| Usage | |
|---|---|
| Application | WB, IHC |
| Dilutions | Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:2500-1:5000) |
| Reactivity | Human |
| Specificity | Specificity of human GPR64 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.