Online Inquiry
GPR61 Antibody
SPA-04734
Size | Price |
0.1 mL | Online Inquiry |
25 µL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | GPR61 |
Gene Abbr. | GPR61 |
Gene ID | 83873 |
Full Name | G protein-coupled receptor 61 |
Alias | BALGR, GPCR3 |
Introduction | This gene belongs to the G-protein coupled receptor 1 family. G protein-coupled receptors contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins. The protein encoded by this gene is most closely related to biogenic amine receptors. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: QFVCFFKPAPEEELRLPSREGSIEENFLQFLQGTGCPSESWVSRPLPSPKQEPPAVDFRIPGQIAEETSEFLEQQLTSDIIMSDSYLRPAASPRLES. |
Usage | |
---|---|
Application | IHC |
Dilutions | Immunohistochemistry (1:50-1:200) |
Reactivity | Human, Mouse, Rat |
Specificity | Specificity of human GPR61 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.