GPR177/WLS Antibody - CD BioSciences

service-banner

GPR177/WLS Antibody

GPR177/WLS Antibody

SPA-04718

Size Price
100 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name GPR177
Gene Abbr. WLS
Gene ID 79971
Full Name Wnt ligand secretion mediator
Alias C1orf139, EVI, GPR177, MRP, mig-14
Introduction GPR177 has signal transducer activity. It is positive regulation of I-kappaB kinase/NF-kappaB cascade.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Immunogen Synthetic peptide directed towards the C-terminal region of human GPR177/WLS. Peptide sequence: WGGVTVQVNSAFFTGIYGMWNLYVFALMFLYAPSHKNYGEDQSNGDLGVH The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Reactivity Human
Storage & Handling
Storage Buffer PBS, 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.