Online Inquiry
GPR177/WLS Antibody
SPA-04715
| Size | Price |
| 100 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | GPR177 |
| Gene Abbr. | WLS |
| Gene ID | 79971 |
| Full Name | Wnt ligand secretion mediator |
| Alias | C1orf139, EVI, GPR177, MRP, mig-14 |
| Introduction | GPR177 has signal transducer activity. It is positive regulation of I-kappaB kinase/NF-kappaB cascade. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to the following amino acid sequence: LAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKD. |
| Usage | |
|---|---|
| Application | WB, IHC |
| Dilutions | Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:20-1:50) |
| Reactivity | Human, Mouse, Rat |
| Specificity | Specificity of human GPR177/WLS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.