GPR161 Antibody - CD BioSciences

service-banner

GPR161 Antibody

GPR161 Antibody

SPA-04696

Size Price
0.05 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name GPR161
Gene Abbr. GPR161
Gene ID 23432
Full Name G protein-coupled receptor 161
Alias RE2
Introduction Upon ligand binding, G protein-coupled receptors, such as GPR161, activate cytoplasmic G proteins (see GNAS, MIM 139320), allowing the receptors to transduce extracellular signals across the plasma membrane into the cell. Phosphorylation of the receptor attenuates signaling (Matteson et al., 2008 [PubMed 18250320]).[supplied by OMIM]
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Synthetic peptides corresponding to GPR161(G protein-coupled receptor 161) The peptide sequence was selected from the N terminal of GPR161. Peptide sequence MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVV. The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB, IHC
Dilutions Western Blot (2.5 µg/mL); Immunohistochemistry (1:10-1:500)
Reactivity Human, Canine, Equine, Rabbit
Storage & Handling
Storage Buffer PBS and 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at -20 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.