Online Inquiry
GPR158 Antibody
SPA-04688
| Size | Price |
| 0.1 mL | Online Inquiry |
| 25 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | GPR158 |
| Gene Abbr. | GPR158 |
| Gene ID | 57512 |
| Full Name | G protein-coupled receptor 158 |
| Introduction | G-protein coupled receptor 158 (GPR158) is a receptor belonging to the Class C GPCRfamily. It lacks the extracellular Venus flytrap module characteristic of theknown members of that family and instead contains two other elements that arenot typical of the class: a calcium-binding EGF-like domain and a leucinenrepeat region. The mature extracellular domain of human GPR158 contains 393 amino acids (aa) and shares 89% identity with both mouse and rat GPR158. GPR158 is expressed at the highest level in the brain, but also in a variety of other tissues including retina, spleen, liver and lung. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Immunogen | Synthetic peptide directed towards the C-terminal region of Human GPR158. Peptide sequence: LPPKAVASKTENENLNQIGHQEKKTSSSEENVRGSYNSSNNFQQPLTSRA The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Reactivity | Human, Equine |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS, 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.