Online Inquiry
GPR125 Antibody
SPA-04630
Size | Price |
0.1 mg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | GPR125 |
Gene Abbr. | ADGRA3 |
Gene ID | 166647 |
Full Name | adhesion G protein-coupled receptor A3 |
Alias | GPR125, PGR21, TEM5L |
Introduction | GPR125 is an orphan receptor which has a leucine rich repeat (LRR), an immunoglobulin (Ig) domain, and a hormone-binding domain (HBD). The Ig domain shows similarities to motilin andtitin, while the LRR domain shows similarities to LRIG1 and SLIT1-2. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: DIFRGLTNLVRLNLSGNLFSSLSQGTFDYLASLRSLEFQTEYLLCDCNILWMHRWVKEKNITVRDTRCVYPKSLQAQPVTGVKQELLTCDPPLELPSFYMTPSHRQVVFEGDSLPFQCMASYIDQDMQVLWYQDGRI. |
Usage | |
---|---|
Application | IHC |
Dilutions | Immunohistochemistry (1:20-1:50) |
Reactivity | Human, Mouse, Rat |
Specificity | Specificity of human GPR125 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.