Online Inquiry
GPR12 Antibody
SPA-04624
| Size | Price |
| 0.05 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | GPR12 |
| Gene Abbr. | GPR12 |
| Gene ID | 2835 |
| Full Name | G protein-coupled receptor 12 |
| Alias | GPCR12, GPCR21, PPP1R84 |
| Introduction | GPR12 is a 7-transmembrane receptor for sphingosylphosphorylcholine. Human GPR12 and the related GPR3 and GPR6 are all highly expressed on neurons of the central nervous system, while GPR12 is particularly expressed in the limbic system. GPR12 engagement promotes proliferation and maturation of postmitotic neurons through an inhibitory G protein and cAMP signaling pathway. Human GPR12 cDNA encodes 334 amino acids (aa), 89 of which are extracellular; these share 86% aa identity with mouse and rat GPR12. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVP. |
| Usage | |
|---|---|
| Application | IHC |
| Dilutions | Immunohistochemistry (1:200-1:500) |
| Reactivity | Human |
| Specificity | Specificity of human GPR12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.