GPR103 Antibody - CD BioSciences

service-banner

GPR103 Antibody

GPR103 Antibody

SPA-04611

Size Price
0.05 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name GPR103
Gene Abbr. QRFPR
Gene ID 84109
Full Name pyroglutamylated RFamide peptide receptor
Alias AQ27, GPR103, SP9155
Introduction The G protein-coupled receptor GPR103 is an Orphan-U GPCR with an unknown ligand.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: MQALNITPEQFSRLLRDHNLTREQFIALYRLRPLVYTPELPGRAKLA.
Usage
Application IHC
Dilutions Immunohistochemistry (1:20-1:50)
Reactivity Human
Specificity Specificity of human GPR103 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.