GPR10 Antibody - CD BioSciences

service-banner

GPR10 Antibody

GPR10 Antibody

SPA-04602

Size Price
0.05 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name GPR10
Gene Abbr. PRLHR
Gene ID 2834
Full Name prolactin releasing hormone receptor
Alias GPR10, GR3, PrRPR
Introduction Prolactin releasing hormone receptor (hGR3/GPR10) is a Releasing Hormone Receptor that controls the secretion of prolactin from the anterior pituitary. Prolactin releasing hormone receptor expression has been documented in human central nervous system (total brain, spinal cord), anterior pituitary, adrenal, cultured placenta decidual cells, and femur, and in rat central nervous system (thalamus, hypothalamus, anterior pituitary), adrenal medulla, testis, and epididymis.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: TTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLK.
Usage
Application IHC
Dilutions Immunohistochemistry (1:50-1:200)
Reactivity Human
Specificity Specificity of human GPR10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.