Online Inquiry
GPR10 Antibody
SPA-04602
| Size | Price |
| 0.05 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | GPR10 |
| Gene Abbr. | PRLHR |
| Gene ID | 2834 |
| Full Name | prolactin releasing hormone receptor |
| Alias | GPR10, GR3, PrRPR |
| Introduction | Prolactin releasing hormone receptor (hGR3/GPR10) is a Releasing Hormone Receptor that controls the secretion of prolactin from the anterior pituitary. Prolactin releasing hormone receptor expression has been documented in human central nervous system (total brain, spinal cord), anterior pituitary, adrenal, cultured placenta decidual cells, and femur, and in rat central nervous system (thalamus, hypothalamus, anterior pituitary), adrenal medulla, testis, and epididymis. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: TTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLK. |
| Usage | |
|---|---|
| Application | IHC |
| Dilutions | Immunohistochemistry (1:50-1:200) |
| Reactivity | Human |
| Specificity | Specificity of human GPR10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.