Online Inquiry
GPER/GPR30 Antibody
SPA-04590
| Size | Price |
| 0.05 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | GPER/GPR30 |
| Gene Abbr. | GPER1 |
| Gene ID | 2852 |
| Full Name | G protein-coupled estrogen receptor 1 |
| Alias | CEPR, CMKRL2, DRY12, FEG-1, GPCR-Br |
| Introduction | GPER (G-Protein Coupled Estrogen Receptor 1; also GPR30, DRY12 and mER) is a 44 kDa, seven transmembrane (TM) member of the GPR-1 family of molecules. It is expressed on/in neurons, monocytes and endothelial cells. Its exact location is unclear; it has been described in both the cell membrane and ER. Human GPER is 375 amino acids (aa) in length. It contains an N-terminal extracellular region (aa 1‑62), a series of seven TM domains (aa 63‑327), and a C-terminal cytoplasmic tail (aa 328‑375). The initial function attributed to GPER was that of a membrane receptor for estrogen. There are two potential splice variants for GPER. One shows a deletion of aa 32-49, while a second shows a 99 aa substitution for aa 308‑375. Over aa 1‑62, human GPER shares 57% aa identity with mouse GPER. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLS. |
| Usage | |
|---|---|
| Application | IHC |
| Dilutions | Immunohistochemistry (1:50-1:200) |
| Reactivity | Human |
| Specificity | Specificity of human GPER/GPR30 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.