Online Inquiry
GnRH Antibody
SPA-04559
Size | Price |
100 µL | Online Inquiry |
0.025 mL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | GnRH |
Gene Abbr. | GNRH1 |
Gene ID | 2796 |
Full Name | gonadotropin releasing hormone 1 |
Alias | GNRH, GRH, LHRH, LNRH |
Introduction | Gonadotropin releasing hormone (GnRH), also known as luteinizing hormone releasing hormone (LHRH), is a key molecule in the regulation of reproduction in vertebrates. GnRH, a decapeptide, is produced by neurons in the medial basal hypothalamus (MBH) and secreted in a pulsatile manner into the cardiovascular system. The frequency and amplitude of GnRH pulses determine secretion of follicle stimulating hormone (FSH) and luteinizing hormone (LH) from the pituitary. Higher frequencies (greater than one pulse per hour) stimulate LH secretion while lower frequencies stimulate FSH secretion. The generation of GnRH pulses is effected by numerous stimuli, such as neural, hormonal and environmental. Therefore, behavioral and physiological conditions such as sleep, exercise, and stress can affect the GnRH pulses and cause a disruption of the normal cycle.Recent studies show that GnRH also has a role in mediating cancer. GnRH has been shown to inhibit the growth of human uterine leiomyloma cells by suppressing proliferation and inducing apoptosis. GnRH analogs have been used to treat a wide variety of reproductive cancers, although the side effects of using such compounds are often quite severe. |
Product Details | |
---|---|
Host | Mouse |
Clonality | Monoclonal |
Clone No. | 4H3 |
Isotype | IgG2A Kappa |
Immunogen | GNRH1 (NP_000816, 24 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI. |
Usage | |
---|---|
Application | WB, ELISA |
Reactivity | Human |
Specificity | GNRH1 - gonadotropin-releasing hormone 1 (luteinizing-releasing hormone). |
Storage & Handling | |
---|---|
Storage Buffer | In 1X PBS, pH 7.4. |
Preservative | No Preservative |
Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.