Online Inquiry
Glucosamine (N-acetyl)-6-Sulfatase/GNS Antibody
SPA-04499
Size | Price |
100 µL | Online Inquiry |
20 µL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | Glucosamine (N-acetyl)-6-Sulfatase |
Gene Abbr. | GNS |
Gene ID | 2799 |
Full Name | glucosamine (N-acetyl)-6-sulfatase |
Alias | G6S |
Introduction | GNS is a lysosomal enzyme found in all cells. It is involved in the catabolism of heparin, heparin sulphate, and keratan sulphate. Deficiency of this enzyme results in the accumulation of undegraded substrate and the lysosomal storage disorder ucopolysaccharidosis type IIID (Sanfilippo D syndrome). Mucopolysaccharidosis type IIID is the least common of the four subtypes of Sanfilippo syndrome.The product of this gene is a lysosomal enzyme found in all cells. It is involved in the catabolism of heparin, heparan sulphate, and keratan sulphate. Deficiency of this enzyme results in the accumulation of undegraded substrate and the lysosomal storage disorder mucopolysaccharidosis type IIID (Sanfilippo D syndrome). Mucopolysaccharidosis type IIID is the least common of the four subtypes of Sanfilippo syndrome. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: NYTLSINGKARKHGENYSVDYLTDVLANVSLDFLDYKSNFEPFFMMIATPAPHSPWTAAPQYQKAFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIQFLDNAFRKRWQTL. |
Usage | |
---|---|
Application | IHC |
Dilutions | Immunohistochemistry (1:20-1:50) |
Reactivity | Human, Mouse, Rat |
Specificity | Specificity of human Glucosamine (N-acetyl)-6-Sulfatase/GNS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.