Online Inquiry
Girdin Antibody
SPA-04461
| Size | Price |
| 100 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Girdin |
| Gene Abbr. | CCDC88A |
| Gene ID | 55704 |
| Full Name | coiled-coil domain containing 88A |
| Alias | APE, GIRDIN, GIV, GRDN, HkRP1 |
| Introduction | Girdin is a Galpha-interacting protein that can enhance the activation of the protein kinase Akt, remodel the actin cytoskeleton, and is thought to be involved in the regulation of cell migration and cancer metastasis. It has recently been shown that Girdin interacts with Disrupted-in-Schizophrenia 1 (DISC1), a susceptibility gene for major psychiatric disorders. DISC1 is thought to be involved in the migration, positioning and differentiation of dentate granule cells (DGCs) during development; depletion of Girdin or blocking the Girdin-DISC1 interaction results in defects in axonal sprouting in the CA3 region of the hippocampus and overextended migration of mispositioning of DGCs, suggesting the Girdin plays a role in postnatal neurogenesis in the dentate gyrus. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: VPDDISTGKRRKELGAMAFSTTAINFSTVNSSAGFRSKQLVNNKDTTSFEDISPQGVSDDSSTGSRVHASRPAS. |
| Usage | |
|---|---|
| Application | IHC |
| Dilutions | Immunohistochemistry (1:200-1:500) |
| Reactivity | Human, Mouse, Rat |
| Specificity | Specificity of human Girdin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.