Online Inquiry
GIP Antibody
SPA-04451
| Size | Price |
| 100 µL | Online Inquiry |
| 20 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | GIP |
| Gene Abbr. | GIP |
| Gene ID | 2695 |
| Full Name | gastric inhibitory polypeptide |
| Introduction | Human gastric inhibitory polypeptide (GIP) is a 42 amino acid peptide belonging to the glucagon-secretin family of peptide hormones. It is secreted by endocrine cells in the duodenal mucosa and stimulates glucose-dependent insulin secretion as well as GLP-1 release from more distal endocrine (L) cells in the intestinal mucosa. GIP shows amino-acid sequence similarities to glucagon, GLP-1 and GLP-2 (from approximately 50% identity for glucagon to 30% identity for GLP-2). |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: KKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKND. |
| Usage | |
|---|---|
| Application | IHC |
| Dilutions | Immunohistochemistry (1:200-1:500) |
| Reactivity | Human |
| Specificity | Specificity of human GIP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.