Online Inquiry
GHRHR Antibody
SPA-04448
Size | Price |
0.05 mL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | GHRHR |
Gene Abbr. | GHRHR |
Gene ID | 2692 |
Full Name | growth hormone releasing hormone receptor |
Alias | GHRFR, GRFR, IGHD1B, IGHD4 |
Introduction | GHRHR, a Growth Hormone-Releasing Hormone Receptor, is involved in the proliferation and differentiation of somatotrophic pituitary cells and in disease. The GHRH receptor stimulates growth hormone (GH) secretion and synthesis in the pituitary. Mutations in this receptor cause either growth-hormone deficiency, resulting in dwarfism, or excessive production of the hormone, leading to gigantism. Four alternative splice variants have been identified that are tissue specific. GHRHR has been reported to be expressed primarily in the brain. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Immunogen | Synthetic peptide directed towards the middle region of human GHRHR. Peptide sequence: PYPVACPVPLELLAEEESYFSTVKIIYTVGHSISIVALFVAITILVALRR The peptide sequence for this immunogen was taken from within the described region. |
Usage | |
---|---|
Application | WB |
Reactivity | Human, Rat, Rabbit |
Storage & Handling | |
---|---|
Storage Buffer | PBS, 2% sucrose. |
Preservative | 0.09% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.