GHRHR Antibody - CD BioSciences

service-banner

GHRHR Antibody

GHRHR Antibody

SPA-04448

Size Price
0.05 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name GHRHR
Gene Abbr. GHRHR
Gene ID 2692
Full Name growth hormone releasing hormone receptor
Alias GHRFR, GRFR, IGHD1B, IGHD4
Introduction GHRHR, a Growth Hormone-Releasing Hormone Receptor, is involved in the proliferation and differentiation of somatotrophic pituitary cells and in disease. The GHRH receptor stimulates growth hormone (GH) secretion and synthesis in the pituitary. Mutations in this receptor cause either growth-hormone deficiency, resulting in dwarfism, or excessive production of the hormone, leading to gigantism. Four alternative splice variants have been identified that are tissue specific. GHRHR has been reported to be expressed primarily in the brain.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Immunogen Synthetic peptide directed towards the middle region of human GHRHR. Peptide sequence: PYPVACPVPLELLAEEESYFSTVKIIYTVGHSISIVALFVAITILVALRR The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Reactivity Human, Rat, Rabbit
Storage & Handling
Storage Buffer PBS, 2% sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.