Online Inquiry
GHRH Antibody
SPA-04441
Size | Price |
0.05 mg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | GHRH |
Gene Abbr. | GHRH |
Gene ID | 2691 |
Full Name | growth hormone releasing hormone |
Alias | GHRF, GRF, INN |
Introduction | The protein encoded by this gene belongs to the glucagon family and is a preproprotein that is produced in the hypothalamus. The preproprotein is cleaved to form a 44 aa factor, also called somatocrinin, that acts to stimulate growth hormone release from the pituitary. Variant receptors for somatocrinin have been found in several types of tumors, and antagonists of these receptors can inhibit the growth of the tumors. Defects in this gene are a cause of dwarfism, while hypersecretion of the encoded protein is a cause of gigantism. [provided by RefSeq] |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Immunogen | Synthetic peptide directed towards the middle region of human GHRH. Peptide sequence: LSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVA The peptide sequence for this immunogen was taken from within the described region. |
Usage | |
---|---|
Application | WB |
Reactivity | Human |
Storage & Handling | |
---|---|
Storage Buffer | PBS, 2% Sucrose. |
Preservative | 0.09% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.