Online Inquiry
Ghrelin/Obestatin Antibody
SPA-04427
Size | Price |
25 µg | Online Inquiry |
100 µg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | Ghrelin |
Gene Abbr. | GHRL |
Gene ID | 51738 |
Full Name | ghrelin and obestatin prepropeptide |
Alias | MTLRP |
Introduction | Mature Ghrelin peptides are the result of the clavage of the Ghrelin/Obestatin Prepropeptide, a 117 aa precursor peptide that is processed into three chains, Ghrelin-27 (aa 24-50), Ghrelin-28 (aa24-51) and Obestatin (aa76-98). The prepropeptide is cleaved into proGhrelin, and then further processed into mature Ghrelin by prohormone convertases. Mature Ghrelin is acylated with an N-octanoyl group on serine 3 which is required for receptor binding. Ghrelin and Obestatin are predominantly synthesized in the gastric mucosa. Ghrelin plays a role in growth factor release and appetite suppression as well as many other functions in a variety of organs. Obestatin is a putative hormone that has been suggested to have opposite effects on growth factor release and appetite as Ghrelin. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: RKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHS. |
Usage | |
---|---|
Application | WB, IHC |
Dilutions | Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:1000-1:2500) |
Reactivity | Human |
Specificity | Specificity of human Ghrelin/Obestatin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.