GHITM Antibody - CD BioSciences

service-banner

GHITM Antibody

GHITM Antibody

SPA-04420

Size Price
0.1 mg Online Inquiry
More Options Online Inquiry
Target Information
Target Name GHITM
Gene Abbr. GHITM
Gene ID 27069
Full Name growth hormone inducible transmembrane protein
Alias DERP2, HSPC282, MICS1, My021, PTD010
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: TKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPSMEKIFKIDQMGRW.
Usage
Application IF, IHC
Dilutions Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:200-1:500)
Reactivity Human, Mouse
Specificity Specificity of human GHITM antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.