Online Inquiry
GFR alpha-3/GDNF R alpha-3 Antibody
SPA-04404
| Size | Price |
| 0.1 mg | Online Inquiry |
| 0.025 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | GDNF Receptor |
| Gene Abbr. | GFRA3 |
| Gene ID | 2676 |
| Full Name | GDNF family receptor alpha 3 |
| Alias | GDNFR3 |
| Introduction | Members of the glial cell line-derived neurotrophic factor (GDNF) family, including GDNF and neurturin (NTN) play essential roles in the control of vertebrate neuron survival and differentiation. A new member of the GDNF family was recently identified and designated persephin. Physiological responses to these neurotrophic factors require two receptor subunits, the novel glycosylphosphadidylinositol linked protein GFRalpha and Ret receptor tyrosine kinase GFRbeta. Following the findings of GFRalpha-1 and -2, a novel receptor in GFRalpha family was identified very recently from human and mouse and designated GFRalpha-3. GFRalpha-3 binds persephin, thus, persephin, GFRalpha-3, and Ret PTK form a complex to transduce persephin signal and to mediate persephin function. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: LPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACL. |
| Usage | |
|---|---|
| Application | WB, IF, IHC |
| Dilutions | Western Blot (0.04-0.4 µg/mL); Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:500-1:1000) |
| Reactivity | Human |
| Specificity | Specificity of human GFR alpha-3/GDNF R alpha-3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.