GFR alpha-2/GDNF R alpha-2 Antibody - CD BioSciences

service-banner

GFR alpha-2/GDNF R alpha-2 Antibody

GFR alpha-2/GDNF R alpha-2 Antibody

SPA-04398

Size Price
25 µg Online Inquiry
500 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name GDNF Receptor
Gene Abbr. GFRA2
Gene ID 2675
Full Name GDNF family receptor alpha 2
Alias GDNFRB, NRTNR-ALPHA, NTNRA, RETL2, TRNR2
Introduction Glial cell line-derived growth factor (GDNF), neurturin (NTN), persephin (PSP) and artemin, distant members of theTGF-beta superfamily, are neurotrophic factors for a variety of neuronal populations in the central and peripheral nervous systems. The bioactivities of GDNF and NTN are mediated through a receptor complex composed of the non ligand-binding signaling subunit (c-Ret receptor tyrosine kinase) and either of two ligand binding subunits (GDNF receptor alpha -1 [GFR alpha -1], also known as GDNF R alpha -1 or Trn R1, or GFR alpha -2, also known as GDNF R alpha -2 or Trn R2). GFR alpha -1 and -2 are members of a family of at least four cysteine-rich glycosyl-phosphatidylinositol (GPI)-linked cell surface proteins that share conserved placements of many of their cysteine residues. Binding of GDNF or NTN to membrane-associated GFR alpha -1 or GFR alpha -2 initiates the association with and activation of the Ret tyrosine kinase.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Synthetic peptide directed towards the C terminal of human GFRA2. Peptide sequence NVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLK. The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Dilutions Western Blot (1:1000)
Reactivity Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
Storage & Handling
Storage Buffer PBS and 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at -20 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.