G6PC Antibody - CD BioSciences

service-banner

G6PC Antibody

G6PC Antibody

SPA-04280

Size Price
0.1 mL Online Inquiry
25 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name G6PC
Gene Abbr. G6PC
Gene ID 2538
Full Name glucose-6-phosphatase catalytic subunit
Alias G6PC, G6PT, G6Pase, GSD1, GSD1a
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFIL.
Usage
Application IHC
Dilutions Immunohistochemistry (1:500-1:1000)
Reactivity Human, Mouse
Specificity Specificity of human G6PC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.