Online Inquiry
G2A/GPR132 Antibody
SPA-04278
| Size | Price |
| 0.025 mL | Online Inquiry |
| 100 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | G2A/GPR132 |
| Gene Abbr. | GPR132 |
| Gene ID | 29933 |
| Full Name | G protein-coupled receptor 132 |
| Alias | G2A |
| Introduction | G2A belongs to the Lysophospholipid/Lysosphingolipid Receptor family and is an anti-proliferative cell cycle regulator that plays a critical role in controlling peripheral lymphocyte homeostasis. Loss of G2A expression leads to the development of a late-onset autoimmune syndrome (Le et al, 2001). Lysophosphatidylcholine (LPC) is the activating ligand for G2A. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: NGYNGNATPVTTTAPWASLGLSAKTCNNVSFEESRI. |
| Usage | |
|---|---|
| Application | IHC |
| Dilutions | Immunohistochemistry (1:20-1:50) |
| Reactivity | Human |
| Specificity | Specificity of human G2A/GPR132 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.