Gα L Antibody - CD BioSciences

service-banner

Gα L Antibody

Gα L Antibody

SPA-04228

Size Price
0.1 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name G protein
Gene Abbr. GNAL
Gene ID 2774
Full Name G protein subunit alpha L
Alias DYT25
Introduction Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: NQFRSDYIKSIAPITDFEYSQEFFDHVKKLWDDEGVKACFER.
Usage
Application IHC
Dilutions Immunohistochemistry (1:500-1:1000)
Reactivity Human, Mouse, Rat
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.