Gα 12 Antibody - CD BioSciences

service-banner

Gα 12 Antibody

Gα 12 Antibody

SPA-04194

Size Price
100 µL Online Inquiry
20 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name G protein
Gene Abbr. GNA12
Gene ID 2768
Full Name G protein subunit alpha 12
Alias NNX3, RMP, gep
Introduction Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Immunogen Synthetic peptide directed towards the C-terminal region of Human G protein alpha 12. Peptide sequence: PDFRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENVRFVFH The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Reactivity Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Storage & Handling
Storage Buffer PBS, 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.