Online Inquiry
FoxO1/FKHR Antibody
SPA-04082
Size | Price |
0.025 mg | Online Inquiry |
0.1 mg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | FoxO |
Gene Abbr. | FOXO1 |
Gene ID | 2308 |
Full Name | forkhead box O1 |
Alias | FKH1, FKHR, FOXO1A |
Introduction | FOXO1A (FKHR or ForkHead in Rhabdomyosarcoma) is a 70 kDa protein which is a member of a subfamily of the forkhead homeotic gene family of transcription factors. Recent studies have shown that this protein can act as either a coactivator or a corepressor of nuclear receptor activity. This action is mediated through the LXXLL motif found in the C terminus of the FOXO1A protein. The specific function of the gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Chromosomal aberrations involving FOXO1A are a cause of rhabdomyosarcoma 2 (RMS2); also known as alveolar rhabdomyosarcoma. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: LTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDM. |
Usage | |
---|---|
Application | WB, IHC |
Dilutions | Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:20-1:50) |
MW(KDa) | 78-82 |
Reactivity | Human, Mouse, Rat |
Specificity | Specificity of human, mouse FoxO1/FKHR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.