Online Inquiry
Follistatin-like 4/FSTL4 Antibody
SPA-04071
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Follistatin-like |
| Gene Abbr. | FSTL4 |
| Gene ID | 23105 |
| Full Name | follistatin like 4 |
| Introduction | FSTL4 (Follistatin-like protein 4; also FSL4, SPIG1 and D/Bsp120I-1) is a likely secreted, 90 kDa (predicted) member of the follistatin gene family of TGF-beta superfamily inhibitors. It is widely expressed, being found in neurons (retinal ganglion and cerebellar Purkinje cells), cardiac muscle cells, smooth muscle cells and intestinal epithelium. Mature mouse FSTL4 is 819 amino acids (aa) in length (aa 23-841). It contains one kazal-like domain (aa 80-134), an EF-hand motif (aa 173-208), and two Ig-like domains (aa 250-336 and 340-425). There are two potential splice forms, one that shows an alternative start site at Met315, and a second that possesses a His residue substitution for aa 518-841. Full-length mature mouse FSTL4 shares 95% and 84% aa identity with rat and human FSTL4, respectively. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: WMDPGTSRGPDVGVGESQAEEPRSFEVTRREGLSSHNELLASCGKKFCSRGSRCVLSRKTGEPECQCLEACRPSYVPVCGS. |
| Usage | |
|---|---|
| Application | IF, IHC |
| Dilutions | Immunofluorescence (1-4 µg/mL); Immunohistochemistry (1:200-1:500) |
| Reactivity | Human, Rat |
| Specificity | Specificity of human Follistatin-like 4/FSTL4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.